You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1976433 |
---|---|
Category | Proteins |
Description | Confers resistance to the different beta-lactams antibiotics (penicillin, cephalosporin and carbapenem) via the hydrolysis of the beta-lactam ring. Metallo-beta-lactamase type 2 Protein, Serratia marcescens, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 32.6 kDa and the accession number is P52699. |
Tag | N-10xHis, C-Myc |
Protein Sequence | AESLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESKKPSKPSN |
UniProt ID | P52699 |
MW | 32.6 kDa (predicted) |
Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
Expression System | E. coli |
Biological Origin | Serratia marcescens |
Expression Region | 19-246 aa |
Storage | -20°C |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |