C16orf73 Rabbit Polyclonal Antibody

• Catalog Number: orb326006
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MEIOB
• Target: MEIOB
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C16orf73
• Protein Sequence: Synthetic peptide located within the following region: CSLTGSVAEETLGCTFVLSHRARSGLKISVLSCKLADPTEASRNLSGQKH
• UniProt ID: Q8N635
• MW: 53 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti MGC35212 antibody, anti gs129 antibody, anti
• Research Area: Molecular Biology, Protein Biochemistry, Stem Cell
• Note: For research use only
• NCBI: NP_689977

Western blot analysis of human Lung tissue using MEIOB antibody