CCDC90A Rabbit Polyclonal Antibody

• Catalog Number: orb579285
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CCDC90A
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CCDC90A
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 40kDa
• Target: MCUR1
• UniProt ID: Q96AQ8
• Protein Sequence: Synthetic peptide located within the following region: ELHQLKQQVMDEVIKVRTDTKLDFNLEKSRVKELYSLNEKKLLELRTEIV
• NCBI: NP_001026883
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: FMP32, C6orf79, CCDC90A
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 3 ug/ml.

Sample Type: Human Fetal Lung, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 0.12.

Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Type: OVCAR-3 Cell lysates, Antibody Dilution: 1.0 ug/ml.

WB Suggested Anti-CCDC90A Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human brain.