MCM2 monoclonal antibody (M01), clone 6A8

• Catalog Number: orb2292611
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant MCM2.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 6A8
• Tested applications: ELISA, IF, IP, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: MCM2 (AAH07670, 805 a.a. ~ 904 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: TQKFSVMRSMRKTFARYLSFRRDNNELLLFILKQLVAEQVTYQRNRFGAQQDTIEVPEKDLVDKARQINIHNLSAFYDSELFRMNKFSHDLKRKMILQQF
• NCBI: AAH07670
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged MCM2 is approximately 0.1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to MCM2 on HeLa cell. [antibody concentration 10 ug/ml]

Immunoprecipitation of MCM2 transfected lysate using anti-MCM2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with MCM2 MaxPab rabbit polyclonal antibody.

MCM2 monoclonal antibody (M01), clone 6A8 Western Blot analysis of MCM2 expression in Hela S3 NE.

Western Blot analysis of MCM2 expression in transfected 293T cell line by MCM2 monoclonal antibody (M01), clone 6A8. Lane 1: MCM2 transfected lysate (101.9 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.63 KDa).