MCCC2 Rabbit Polyclonal Antibody (Biotin)

SKU: orb2116942

Description

MCCC2 Rabbit Polyclonal Antibody (Biotin) is a Biotin, affinity purified antibody which is suitable for WB application. The immunogen is a synthetic peptide directed towards the C-terminal region of human MCCC2. This antibody is predicted to react with Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer.

Images & Validation

• Tested Applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human MCCC2
• Protein Sequence: Synthetic peptide located within the following region: RKVVRNLNYQKKLDVTIEPSEEPLFPADELYGIVGANLKRSFDVREVIAR
• Molecular Weight: 36kDa
• Purification: Affinity Purified
• Conjugation: Biotin

Storage & Handling

• Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer.
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

MCCB, MCCCbeta

Quick Database Links

UniProt

Q9HCC0

RefSeq (Protein):NP_071415.1