MBD2 Rabbit Polyclonal Antibody

SKU: orb330096

Description

MBD2 Rabbit Polyclonal Antibody is an unconjugated, Protein A purified antibody for the detection of MBD2. It is suitable for KO/KD Validated, WB applications. The immunogen is a synthetic peptide directed towards the middle region of human MBD2. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Metabolism Research

Images & Validation

• Tested Applications: KO/KD Validated, WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MBD2
• Target: MBD2
• Protein Sequence: Synthetic peptide located within the following region: DCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNT
• Molecular Weight: 32kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti DMTase antibody, anti NY-CO-41 antibody

Lanes: Lane 1: 15 ug WT mouse ES lysate, Lane 2: 15 ug MBD2 KO mouse ES lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Goat anti-rabbit-HRP, Secondary Antibody Dilution: 1:2500, Gene Name: MBD2 a.

Rabbit Anti-MBD2 Antibody, Catalog Number: orb330096, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Nucleus, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec.

WB Suggested Anti-MBD2 Antibody Titration: 0.625 ug/mL, ELISA Titer: 1:1562500, Positive Control: HepG2 cell lysate.

Quick Database Links

Gene Symbol

MBD2

UniProt

Q9UBB5

RefSeq (Protein):NP_056647