MATN1 Rabbit Polyclonal Antibody

• Catalog Number: orb578313
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MATN1
• Target: MATN1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MATN1
• Protein Sequence: Synthetic peptide located within the following region: KYLIDNSFTVSSGARPGAQKVGIVFTDGRSQDYINDAAKKAKDLGFKMFA
• UniProt ID: P21941
• MW: 54kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: CMP, CRTM
• Research Area: Disease Biomarkers, Signal Transduction
• Note: For research use only
• NCBI: NP_002370

WB Suggested Anti-MATN1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: OVCAR-3 cell lysate. MATN1 is strongly supported by BioGPS gene expression data to be expressed in Human OVCAR3 cells.