MASP2 Rabbit Polyclonal Antibody

• Catalog Number: orb578119
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MASP2
• Target: MASP2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MASP2
• Protein Sequence: Synthetic peptide located within the following region: FPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAK
• UniProt ID: O00187
• MW: 27kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: sMAP, MAP19, MASP-2, MASP1P1
• Research Area: Disease Biomarkers, Immunology & Inflammation, Sig
• Note: For research use only
• NCBI: NP_006601

Rabbit Anti-MASP2 Antibody, Catalog Number: orb578119, Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver, Observed Staining: Cytoplasm in hepatocytes, weak signal, wide tissue distribution, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-MASP2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: OVCAR-3 cell lysate. MASP2 is strongly supported by BioGPS gene expression data to be expressed in Human OVCAR3 cells.