MAP7D1 Rabbit Polyclonal Antibody

SKU: orb583446

Description

Rabbit polyclonal antibody to MAP7D1

Research Area

Epigenetics

Images & Validation

• Tested Applications: WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MAP7D1
• Target: MAP7D1
• Protein Sequence: Synthetic peptide located within the following region: RRRLEEQRLKAEQRRAALEERQRQKLEKNKERYEAAIQRSVKKTWAEIRQ
• Molecular Weight: 93 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

RPRC1, PARCC1

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The protein may be modified by phophorylation.

Lanes: Lane 1: 10 ug L929 lysate, Lane 2: 10 ug L929+MAP7D1 siRNA, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:2000, Gene Name: MAP7D1.

WB Suggested Anti-MAP7D1 Antibody Titration: 0.2-1 ug/ml, Positive Control: 293T cell lysate.

Quick Database Links

Gene Symbol

MAP7D1

UniProt

Q3KQU3

RefSeq (Protein):NP_060537