MAP4K4 monoclonal antibody (M07), clone 4A5

• Catalog Number: orb2291720
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant MAP4K4.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4A5
• Tested applications: ELISA, IHC-P, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: MAP4K4 (NP_663719, 611 a.a. ~ 710 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: VHPALQRPAEPQVQWSHLASLKNNVSPVSRSHSFSDPSPKFAHHHLRSQDPCPPSRSEVLSQSSDSKSEAPDPTQKAWSRSDSDEVPPRVPVRTTSRSPV
• NCBI: NP_663719
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged MAP4K4 is approximately 0.03 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to MAP4K4 on formalin-fixed paraffin-embedded human breast cancer. [antibody concentration 3 ug/ml]

MAP4K4 monoclonal antibody (M07), clone 4A5 Western Blot analysis of MAP4K4 expression in K-562.

Western Blot detection against Immunogen (36.63 KDa).