You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291720 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant MAP4K4. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG1 Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | MAP4K4 (NP_663719, 611 a.a. ~ 710 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | VHPALQRPAEPQVQWSHLASLKNNVSPVSRSHSFSDPSPKFAHHHLRSQDPCPPSRSEVLSQSSDSKSEAPDPTQKAWSRSDSDEVPPRVPVRTTSRSPV |
Tested applications | ELISA, IHC-P, WB |
Clone Number | 4A5 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_663719 |
Detection limit for recombinant GST tagged MAP4K4 is approximately 0.03 ng/ml as a capture antibody.
Immunoperoxidase of monoclonal antibody to MAP4K4 on formalin-fixed paraffin-embedded human breast cancer. [antibody concentration 3 ug/ml]
MAP4K4 monoclonal antibody (M07), clone 4A5 Western Blot analysis of MAP4K4 expression in K-562.
Western Blot detection against Immunogen (36.63 KDa).