Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Map2k1 Rabbit Polyclonal Antibody

SKU: orb584884

Description

Map2k1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of Map2k1. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Map2k1. This antibody reacts with Mouse samples and is predicted to react with Bovine, Canine, Guinea pig, Human, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Signal Transduction

Images & Validation

Tested ApplicationsWB
ReactivityMouse
Predicted ReactivityBovine, Canine, Guinea pig, Human, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Map2k1
TargetMap2k1
Protein SequenceSynthetic peptide located within the following region: KKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAF
Molecular Weight43kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Mek1, Prkm, MEKK1, MAPKK1, Prkmk1

Similar Products

  • MEK-1 (phospho Thr292) rabbit pAb Antibody [orb769695]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • MEK-1/2 rabbit pAb Antibody [orb765647]

    ELISA,  IF,  IHC,  WB

    Human, Monkey, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl
  • MEK-1/2 (phospho Ser218/222) rabbit pAb Antibody [orb764230]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl
  • MEK1 Antibody (Center S217/221) [orb1932918]

    IHC-P,  WB

    C. elegans, Drosophila, Hamster, Other, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • Mouse Map2k1 Antibody (C-term) [orb1436819]

    IHC-P,  WB

    Hamster, Rabbit, Rat

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Map2k1 Rabbit Polyclonal Antibody

Sample Type: Mouse Liver lysates, Antibody dilution: 1.0 ug/ml.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_032953

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

Map2k1 Rabbit Polyclonal Antibody (orb584884)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry