FLJ36070 Rabbit Polyclonal Antibody

• Catalog Number: orb326039
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MAMSTR
• Target: MAMSTR
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FLJ36070
• Protein Sequence: Synthetic peptide located within the following region: QPHPRMKPSPLTPCPPGVPSPSPPPHKLELQTLKLEELTVSELRQQLRLR
• UniProt ID: Q6ZN01
• MW: 33kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti FLJ36070 antibody, anti MASTR antibody, anti
• Note: For research use only
• NCBI: NP_872380

WB Suggested Anti-FLJ36070 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Human heart.