RP11-217H1.1 Rabbit Polyclonal Antibody

• Catalog Number: orb326272
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MAGT1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RP11-217H1.1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 38 kDa
• Target: MAGT1
• UniProt ID: B4DH58
• Protein Sequence: Synthetic peptide located within the following region: ARWRFWCVSVTMVVALLIVCDVPSASAQRKKEMVLSEKVSQLMEWTNKRP
• NCBI: NP_115497
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti DKFZp564K142 antibody, anti FLJ14726 antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.2 ug/mL of the antibody was used in this experiment.

Sample Type: PANC1, Antibody Dilution: 1.0 ug/mL, MAGT1 is supported by BioGPS gene expression data to be expressed in PANC1.

WB Suggested Anti-RP11-217H1.1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: Human brain.