MAGEA4 monoclonal antibody (M01), clone 3D12

• Catalog Number: orb2292619
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant MAGEA4.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3D12
• Tested applications: ELISA, IF, WB
• Reactivity: Human
• Isotype: IgG2b Kappa
• Immunogen: MAGEA4 (NP_002353, 98 a.a. ~ 171 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: TSPDAESLFREALSNKVDELAHFLLRKYRAKELVTKAEMLERVIKNYKRCFPVIFGKASESLKMIFGIDVKEVD
• NCBI: NP_002353
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged MAGEA4 is approximately 0.3 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to MAGEA4 on HeLa cell. [antibody concentration 10 ug/ml]

MAGEA4 monoclonal antibody (M01), clone 3D12 Western Blot analysis of MAGEA4 expression in Hela S3 NE.