You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292619 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant MAGEA4. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG2b Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | MAGEA4 (NP_002353, 98 a.a. ~ 171 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | TSPDAESLFREALSNKVDELAHFLLRKYRAKELVTKAEMLERVIKNYKRCFPVIFGKASESLKMIFGIDVKEVD |
Tested applications | ELISA, IF, WB |
Clone Number | 3D12 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_002353 |
Detection limit for recombinant GST tagged MAGEA4 is approximately 0.3 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to MAGEA4 on HeLa cell. [antibody concentration 10 ug/ml]
MAGEA4 monoclonal antibody (M01), clone 3D12 Western Blot analysis of MAGEA4 expression in Hela S3 NE.