MAF Rabbit Polyclonal Antibody

• Catalog Number: orb576761
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MAF
• Target: MAF
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Equine
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human MAF
• Protein Sequence: Synthetic peptide located within the following region: DAYKEKYEKLVSSGFRENGSSSDNPSSPEFFITEPTRKLEPSVGYATFWK
• UniProt ID: O75444
• MW: 42kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: CCA4, AYGRP, c-MAF, CTRCT21
• Note: For research use only
• NCBI: NP_005351

Sample Type: Lung Tumor lysates, Antibody Dilution: 1.0 ug/ml.

Rabbit Anti-MAF Antibody, Catalog Number: orb576761, Paraffin Embedded Tissue: Human Lung cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.