MAD2L1BP Rabbit Polyclonal Antibody

SKU: orb584998

Description

Rabbit polyclonal antibody to MAD2L1BP

Research Area

Cell Biology, Epigenetics & Chromatin, Molecular Biology, Signal Transduction

Images & Validation

−

Item 1 of 1

Tested Applications	WB
Reactivity	Human
Predicted Reactivity	Canine, Equine, Porcine

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Target	MAD2L1BP
Protein Sequence	Synthetic peptide located within the following region: SAAVPDLEWYEKSEETHASQIELLETSSTQEPLNASEAFCPRDCMVPVVF
Molecular Weight	30kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

CMT2

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

WB Suggested Anti-MAD2L1BP Antibody, Titration: 1.0 ug/ml, Positive Control: MDA-MB-435S Whole Cell. MAD2L1BP is supported by BioGPS gene expression data to be expressed in MDA-MB435.

Quick Database Links

Gene Symbol

MAD2L1BP

UniProt

Q15013

RefSeq (Protein):NP_055443

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_055443

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

Find More Protocols