Cart summary

You have no items in your shopping cart.

LYSMD2 Rabbit Polyclonal Antibody (FITC)

LYSMD2 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2104794

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2104794
CategoryAntibodies
DescriptionLYSMD2 Rabbit Polyclonal Antibody (FITC)
ClonalityPolyclonal
Species/HostRabbit
ConjugationFITC
Predicted ReactivityBovine, Guinea pig, Human, Mouse, Porcine, Rabbit, Zebrafish
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human LYSMD2
Protein SequenceSynthetic peptide located within the following region: VEHRVRAGDTLQGIALKYGVTMEQIKRANKLFTNDCIFLKKTLNIPVISE
UniProt IDQ8IV50
MW23kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesDKFZp686I2243, MGC35274
NoteFor research use only
NCBINP_699205