LTB4R Rabbit Polyclonal Antibody

SKU: orb324368

Description

Rabbit polyclonal antibody to LTB4-R1

Research Area

Cardiovascular Research, Immunology & Inflammation, Pharmacology & Drug Discovery

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Human

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human LTB4R
• Target: LTB4R
• Protein Sequence: Synthetic peptide located within the following region: AGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVG
• Molecular Weight: 37kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti-LTB4 R 1 antibody, anti-LTB4-R 1 antibody, anti-LTB4-R1 antibody, anti-LTB4R 1 antibody, anti-Ltb4r antibody, anti-LTB4R1 antibody, anti-LTBR1 antibody, anti-Chemoattractant receptor-like 1 antibody, anti-Chemokine receptor like 1 antibody, anti-Leukotriene B4 G Protein coupled receptor antibody, anti-Leukotriene B4 receptor 1 antibody, anti-Leukotriene B4 receptor antibody, anti-BLT antibody, anti-BLT1 antibody, anti-BLTR antibody, anti-LTB4 receptor 1 antibody

WB Suggested Anti-LTB4R Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: PANC1 cell lysate.

Quick Database Links

Gene Symbol

LTB4R

UniProt

Q15722

RefSeq (Protein):NP_858043