C1orf92 Rabbit Polyclonal Antibody

• Catalog Number: orb325779
• Category: Antibodies
• Description: Rabbit polyclonal antibody to LRRC71
• Target: LRRC71
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C1orf92
• Protein Sequence: Synthetic peptide located within the following region: VDKTDKTQTMKTPKGLGKKKEKSWELAKKEEKLGSGQSPTQGTPKKEDAT
• UniProt ID: Q8N4P6
• MW: 39kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti FLJ32884 antibody, anti MGC45468 antibody, an
• Note: For research use only
• NCBI: NP_653303

WB Suggested Anti-C1orf92 Antibody Titration: 0.2-1 ug/mL, Positive Control: THP-1 cell lysate.