LRP1 Rabbit Polyclonal Antibody

• Catalog Number: orb584039
• Category: Antibodies
• Description: Rabbit polyclonal antibody to LRP1
• Target: LRP1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LRP1
• Protein Sequence: Synthetic peptide located within the following region: ATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCAR
• UniProt ID: Q07954
• MW: 48kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: APR, KPA, LRP, A2MR, CD91, APOER, LRP1A, TGFBR5, I
• Research Area: Cell Biology, Pharmacology & Drug Discovery
• Note: For research use only
• NCBI: AAH21204

Lanes: Human placenta Primary Antibody dilution: 1:500, Secondary Antibody: Anti-rabbit-HRP Secondary Antibody dilution: 1:5000.

WB Suggested Anti-LRP1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: 721_B cell lysate.