LPIN1 Rabbit Polyclonal Antibody

SKU: orb582242

Description

Rabbit polyclonal antibody to LPIN1

Research Area

Metabolism Research

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep, Yeast, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LPIN1
• Target: LPIN1
• Protein Sequence: Synthetic peptide located within the following region: SLAVIYPQSASYPNSDREWSPTPSPSGSRPSTPKSDSELVSKSTERTGQK
• Molecular Weight: 98kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

PAP1

Rabbit Anti-LPIN1 Antibody, Catalog Number: orb582242, Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue, Observed Staining: Cytoplasmic and membrane in cell bodies and processes of pinealocytes, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-LPIN1 Antibody Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate. LPIN1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

Quick Database Links

Gene Symbol

LPIN1

UniProt

Q14693

RefSeq (Protein):NP_663731