LOXL1 Rabbit Polyclonal Antibody

• Catalog Number: orb582476
• Category: Antibodies
• Description: Rabbit polyclonal antibody to LOXL1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LOXL1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 63 kDa
• Target: LOXL1
• UniProt ID: Q08397
• Protein Sequence: Synthetic peptide located within the following region: RWRQLIQWENNGQVYSLLNSGSEYVPAGPQRSESSSRVLLAGAPQAQQRR
• NCBI: NP_005567
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: LOL, LOXL
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human 293T Whole Cell, Antibody dilution: 3 ug/ml.

Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 3 ug/ml.

Sample Tissue: Human OVCAR-3 Whole Cell, Antibody dilution: 3 ug/ml.

Positive control (+): Stomach tumor (T-ST), Negative control (-): HepG2 (HG), Antibody concentration: 3 ug/ml.

WB Suggested Anti-LOXL1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.