LIN37 Rabbit Polyclonal Antibody

• Catalog Number: orb330919
• Category: Antibodies
• Description: Rabbit polyclonal antibody to LIN37
• Target: LIN37
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LIN37
• Protein Sequence: Synthetic peptide located within the following region: HQRRKKRREMDDGLAEGGPQRSNTYVIKLFDRSVDLAQFSENTPLYPICR
• UniProt ID: Q96GY3
• MW: 28 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti F25965 antibody, anti MGC9505 antibody, anti
• Note: For research use only
• NCBI: NP_061977

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/ml of the antibody was used in this experiment.

WB Suggested Anti-LIN37 Antibody Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.