You have no items in your shopping cart.
Cart summary
Item 1 of 1
LILRA1 Rabbit Polyclonal Antibody
Catalog Number: orb586043
| Catalog Number | orb586043 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to LILRA1 |
| Target | LILRA1 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Human |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human LILRA1 |
| Protein Sequence | Synthetic peptide located within the following region: FGSFILCKEGEDEHPQCLNSQPRTHGWSRAIFSVGPVSPSRRWSYRCYAY |
| UniProt ID | O75019 |
| MW | 31kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | LIR6, CD85I, LIR-6 |
| Note | For research use only |
Sample Type: MDA-MB-435S Whole cell lysates, Antibody dilution: 1.0 ug/ml. LILRA1 is strongly supported by BioGPS gene expression data to be expressed in Human MDA-MB435 cells.
- Item 1 of 4
- Item 1 of 4
- Item 1 of 1
Anti-CD85i Antibody [orb215034]
WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
30 μl, 100 μl, 200 μl - Item 1 of 2
- Item 1 of 2
