LETM1 Rabbit Polyclonal Antibody

• Catalog Number: orb579913
• Category: Antibodies
• Description: Rabbit polyclonal antibody to LETM1
• Target: LETM1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LETM1
• Protein Sequence: Synthetic peptide located within the following region: MALKNKAAKGSATKDFSVFFQKIRETGERPSNEEIMRFSKLFEDELTLDN
• UniProt ID: O95202
• MW: 60kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: SLC55A1
• Research Area: Epigenetics
• Note: For research use only
• NCBI: EAW82560

WB Suggested Anti-LETM1 Antibody Titration: 5.0 ug/ml, Positive Control: Jurkat cell lysate. LETM1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.