You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291156 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full length recombinant LEF1. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG1 kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | LEF1 (AAH50632, 1 a.a. ~ 399 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | MPQLSGGGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNMNNDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNSKQGMSRHPPAPDIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSMSRFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKREKLQESASGTGPRMTAAYI |
Tested applications | ELISA, WB |
Clone Number | 3H5 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | AAH50632 |
Detection limit for recombinant GST tagged LEF1 is approximately 0.3 ng/ml as a capture antibody.
LEF1 monoclonal antibody (M01), clone 3H5 Western Blot analysis of LEF1 expression in MES-SA/Dx5.
LEF1 monoclonal antibody (M01), clone 3H5. Western Blot analysis of LEF1 expression in HL-60.
Western Blot analysis of LEF1 expression in transfected 293T cell line by LEF1 monoclonal antibody (M01), clone 3H5. Lane 1: LEF1 transfected lysate(44.2 KDa). Lane 2: Non-transfected lysate.
Western blot analysis of LEF1 over-expressed 293 cell line, cotransfected with LEF1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with LEF1 monoclonal antibody (M01), clone 3H5 (Cat # orb2291156). GAPDH (36.1 kDa) used as specificity and loading control.
Western Blot detection against Immunogen (69.63 KDa).