You have no items in your shopping cart.
Cart summary
LECT2 Protein, Mouse, Recombinant (His & Myc)
Catalog Number: orb1977164
| Catalog Number | orb1977164 |
|---|---|
| Category | Proteins |
| Description | LECT2 Protein, Mouse, Recombinant (His & Myc) is expressed in Yeast. |
| Tag | C-6xHis-Myc |
| Purity | 98.00% |
| MW | 18.4 kDa (predicted) |
| UniProt ID | O88803 |
| Protein Sequence | GPWANICASKSSNEIRTCDSYGCGQYSAQRTQRHHPGVDVLCSDGSVVYAPFTGKIVGQEKPYRNKNAINDGIRLSGRGFCVKIFYIKPIKYKGSIKKGEKLGTLLPLQKIYPGIQSHVHVENCDSSDPTAYL |
| Expression System | P. pastoris (Yeast) |
| Biological Origin | Mouse |
| Biological Activity | LECT2 Protein, Mouse, Recombinant (His & Myc) is expressed in Yeast. |
| Expression Region | 19-151 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Expiration Date | 6 months from date of receipt. |
