You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
LCN1 Rabbit Polyclonal Antibody
Catalog Number: orb582434
| Catalog Number | orb582434 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to LCN1 |
| Target | LCN1 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Mouse, Porcine, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human LCN1 |
| Protein Sequence | Synthetic peptide located within the following region: IRSHVKDHYIFYCEGELHGKPVRGVKLVGRDPKNNLEALEDFEKAAGARG |
| UniProt ID | P31025 |
| MW | 17kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | TP, TLC, PMFA, VEGP |
| Note | For research use only |
| NCBI | NP_002288 |
Sample Tissue: Human 293T Whole Cell, Antibody dilution: 1 ug/ml.
WB Suggested Anti-LCN1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.
- Item 1 of 6
- Item 1 of 4
Lipocalin-1 rabbit pAb [orb766824]
ELISA, IHC-P, WB
Human, Mouse, Rat
Polyclonal
Unconjugated
100 μl, 50 μl - Item 1 of 2
- Item 1 of 1
Lipocalin 1/LCN1 Rabbit Polyclonal Antibody (PE-Cy5.5) [orb872349]
ICC, IF
Human
Rabbit
Polyclonal
PE/Cy5.5
100 μl
