LARP7 Rabbit Polyclonal Antibody

• Catalog Number: orb577801
• Category: Antibodies
• Description: Rabbit polyclonal antibody to LARP7
• Target: LARP7
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human LARP7
• Protein Sequence: Synthetic peptide located within the following region: WQKILVDRQAKLNQPREKKRGTEKLITKAEKIRLAKTQQASKHIRFSEYD
• UniProt ID: Q4G0J3
• MW: 67kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: ALAZS, PIP7S, hLARP7, HDCMA18P
• Research Area: Epigenetics
• Note: For research use only
• NCBI: NP_056269

Sample Tissue: Human Hela, Antibody Dilution: 1.0 ug/ml.

Sample Type: Hela Whole cell, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane, Gel Concentration: 0.12%.

WB Suggested Anti-LARP7 Antibody Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.