You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292664 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant LAMB3. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG1 Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | LAMB3 (NP_000219, 1064 a.a. ~ 1171 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | AEGASEQALSAQEGFERIKQKYAELKDRLGQSSMLGEQGARIQSVKTEAEELFGETMEMMDRMKDMELELLRGSQAIMLRSADLTGLEKRVEQIRDHINGRVLYYATC |
Tested applications | ELISA, IF, WB |
Clone Number | 2G10 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_000219 |
Detection limit for recombinant GST tagged LAMB3 is approximately 0.03 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to LAMB3 on A-431 cell. [antibody concentration 10 ug/ml]
LAMB3 monoclonal antibody (M01), clone 2G10 Western Blot analysis of LAMB3 expression in A-431.
Western Blot detection against Immunogen (37.62 KDa).