Lacc1 Rabbit Polyclonal Antibody

SKU: orb325826

Description

Rabbit polyclonal antibody to Lacc1

Research Area

Cell Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Target: Lacc1
• Protein Sequence: Synthetic peptide located within the following region: LERGGILPQNIQDQKEDLDLCTSCHPEKFFSHVRDGLNFGTQIGFISLRE
• Molecular Weight: 48 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti Lacc1 antibody, anti 9030625A04Rik antibody

25 ug of the indicated Mouse whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 5 ug/mL of the antibody was used in this experiment. Protein is modified by glycosylation.

LACC1 was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with orb325826 with 1:200 dilution. Western blot was performed using orb325826 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: LACC1 IP with orb325826 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

WB Suggested Anti-9030625A04Rik Antibody, Titration: 1.0 ug/mL, Positive Control: Mouse Heart.

Quick Database Links

Gene Symbol

Lacc1

UniProt

Q8BZT9

RefSeq (Protein):NP_766076