L3MBTL2 Rabbit Polyclonal Antibody

SKU: orb573572

Description

Rabbit polyclonal antibody to L3MBTL2

Research Area

Cell Biology, Epigenetics & Chromatin

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human L3MBTL2
• Target: L3MBTL2
• Protein Sequence: Synthetic peptide located within the following region: EYDQWVDCESPDIYPVGWCELTGYQLQPPVAAEPATPLKAKEATKKKKKQ
• Molecular Weight: 79kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

L3MBT, H-l(3)mbt-l

Rabbit Anti-L3MBTL2 Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-L3MBTL2 Antibody Titration: 0.625 ug/ml, ELISA Titer: 1:312500, Positive Control: Transfected 293T.

Quick Database Links

Gene Symbol

L3MBTL2

UniProt

Q969R5

RefSeq (Protein):NP_113676