You have no items in your shopping cart.
KRTCAP2 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human KRTCAP2 |
| Target | KRTCAP2 |
| Protein Sequence | Synthetic peptide located within the following region: GLIHRVCVTTCFIFSMVGLYYINKISSTLYQAAAPVLTPAKVTGKSKKRN |
| Molecular Weight | 17kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−KRTCAP2 Rabbit Polyclonal Antibody [orb1880847]
IHC, WB
Human, Mouse
Rabbit
Polyclonal
Unconjugated
200 μl, 100 μl, 50 μl, 30 μlKRTCAP2 Rabbit Polyclonal Antibody (HRP) [orb2085998]
WB
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat
Rabbit
Polyclonal
HRP
100 μlKRTCAP2 Rabbit Polyclonal Antibody (FITC) [orb2085999]
WB
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat
Rabbit
Polyclonal
FITC
100 μlKRTCAP2 Rabbit Polyclonal Antibody (Biotin) [orb2086000]
WB
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat
Rabbit
Polyclonal
Biotin
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1 ug/mL.

KRTCAP2 was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb327018 with 1:200 dilution. Western blot was performed using orb327018 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: KRTCAP2 IP with orb327018 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.
Documents Download
Request a Document
KRTCAP2 Rabbit Polyclonal Antibody (orb327018)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review

