KRT77 Rabbit Polyclonal Antibody

SKU: orb326588

Description

Rabbit polyclonal antibody to KRT77

Research Area

Epigenetics

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat, Sheep

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human KRT77
• Target: KRT77
• Protein Sequence: Synthetic peptide located within the following region: VRTQYELIAQRSKDEAEALYQTKYQELQITAGRHGDDLKNSKMEIAELNR
• Molecular Weight: 62kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti K1B antibody, anti KRT1B antibody, anti MGC148087 antibody

WB Suggested Anti-KRT77 Antibody, Titration: 1.0 ug/mL, Positive Control: 721_B Whole Cell.

Quick Database Links

Gene Symbol

KRT77

UniProt

Q7Z794

RefSeq (Protein):NP_778253