KRT34 Rabbit Polyclonal Antibody

• Catalog Number: orb587505
• Category: Antibodies
• Description: Rabbit polyclonal antibody to KRT34
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Sheep
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human KRT34
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 49kDa
• Target: KRT34
• UniProt ID: O76011
• Protein Sequence: Synthetic peptide located within the following region: NVESQLAEIRCDLERQNQEYQVLLDVRARLECEINTYRSLLESEDCKLPC
• NCBI: XP_003403930
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: HA4, K34, Ha-4, hHa4, KRTHA4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 1 ug/ml.