Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

KRT17 Rabbit Polyclonal Antibody

SKU: orb578189

Description

KRT17 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of KRT17. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the C terminal region of human KRT17. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Disease Biomarkers

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human KRT17
TargetKRT17
Protein SequenceSynthetic peptide located within the following region: IATYRRLLEGEDAHLTQYKKEPVTTRQVRTIVEEVQDGKVISSREQVHQT
Molecular Weight48kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

PC, K17, PC2, 39.1, CK-17, PCHC1

Similar Products

  • Pan Cytokeratin Rabbit Polyclonal Antibody [orb10399]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Gallus, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Cytokeratin 17 rabbit pAb Antibody [orb765002]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • KRT17 Specific Rabbit Polyclonal Antibody [orb394955]

    ELISA,  IF,  IHC,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • KRT17 Antibody [orb685438]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • Phospho-Cytokeratin 17 (Ser44) Rabbit Polyclonal Antibody [orb5870]

    ICC,  WB

    Mouse, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 50 μl, 200 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

KRT17 Rabbit Polyclonal Antibody

Rabbit Anti-KRT17 Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

KRT17 Rabbit Polyclonal Antibody

Rabbit Anti-KRT17 Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

KRT17 Rabbit Polyclonal Antibody

WB Suggested Anti-KRT17 Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.

KRT17 Rabbit Polyclonal Antibody

WB Suggested Anti-KRT17 antibody Titration: 1 ug/ml, Sample Type: Human Hela.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_000413

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

KRT17 Rabbit Polyclonal Antibody (orb578189)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry