KRT15 Rabbit Polyclonal Antibody

• Catalog Number: orb592637
• Category: Antibodies
• Description: Rabbit polyclonal antibody to KRT15
• Target: KRT15
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Mouse
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human KRT15
• Protein Sequence: Synthetic peptide located within the following region: RSLLEGQDAKMAGIGIREASSGGGGSSSNFHINVEESVDGQVVSSHKREI
• UniProt ID: P19012
• MW: 49kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: K15, CK15, K1CO
• Research Area: Epigenetics
• Note: For research use only
• NCBI: NP_002266

WB Suggested Anti-KRT15 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human brain.

WB Suggested Anti-KRT15 antibody Titration: 1 ug/ml, Sample Type: Human Hela.

WB Suggested Anti-KRT15 antibody Titration: 1 ug/ml, Sample Type: Human HepG2.

WB Suggested Anti-KRT15 Antibody Titration: 4.0-8.0, Positive Control: Human Intestine.