Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

KRT14 Rabbit Polyclonal Antibody

SKU: orb592820

Description

KRT14 Rabbit Polyclonal Antibody is an unconjugated, Protein A purified antibody for the detection of KRT14. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the C terminal region of human KRT14. This antibody reacts with Human, Mouse samples and is predicted to react with Guinea pig, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Mouse
Predicted ReactivityGuinea pig, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human KRT14
TargetKRT14
Protein SequenceSynthetic peptide located within the following region: DAHLSSSQFSSGSQSSRDVTSSSRQIRTKVMDVHDGKVVSTHEQVLRTKN
Molecular Weight52kDa
PurificationProtein A purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration1.0 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

K14, NFJ, CK14, EBS3, EBS4

Similar Products

  • Pan Cytokeratin Rabbit Polyclonal Antibody [orb10399]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Gallus, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • CK14+17+42+10 Rabbit Polyclonal Antibody [orb13340]

    IF,  IHC-Fr,  IHC-P,  WB

    Rat

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Cytokeratin 14/16 rabbit pAb Antibody [orb768908]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • Cytokeratin 14/KRT14 Rabbit Polyclonal Antibody [orb389423]

    FC,  ICC,  IHC,  IHC-Fr,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • Cytokeratin 14 rabbit pAb Antibody [orb766778]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_000517

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

Available Sizes

Select a size below

100 μl
$ 550.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry