KRT13 Rabbit Polyclonal Antibody

SKU: orb330219

Description

Rabbit polyclonal antibody to KRT13

Research Area

Disease Biomarkers

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human KRT13
• Target: KRT13
• Protein Sequence: Synthetic peptide located within the following region: EAQLSELRSEMECQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKKRQPP
• Molecular Weight: 46kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti CK13 antibody, anti K13 antibody, anti MGC161462 antibody, anti MGC3781 antibody

Positive control (+): Hela (HL), Negative control (-): Human lung (LU), Antibody concentration: 1 ug/mL.

Rabbit Anti-KRT13 Antibody, Paraffin Embedded Tissue: Human Lung, Cellular Data: Alveolar cells, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

WB Suggested Anti-KRT13 Antibody Titration: 2.5 ug/mL, Positive Control: Jurkat cell lysate.

Quick Database Links

Gene Symbol

KRT13

UniProt

P13646

RefSeq (Protein):NP_002265