You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1977178 |
---|---|
Category | Proteins |
Description | Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin. Klk1b22 Protein, Mouse, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 41.8 kDa and the accession number is P15948. |
Tag | N-6xHis-SUMO |
Purity | 98.00% |
Protein Sequence | ILGGFKCEKNSQPWQVAVYYLDEYLCGGVLLDRNWVLTAAHCYEDKYNIWLGKNKLFQDEPSAQHRLVSKSFPHPDFNMSLLQSVPTGADLSNDLMLLRLSKPADITDVVKPIDLPTTEPKLGSTCLASGWGSINQLIYQNPNDLQCVSIKLHPNEVCVKAHILKVTDVMLCAGEMNGGKDTCKGDSGGPLICDGVLQGITSWGSTPCGEPNAPAIYTKLIKFTSWIKDTMAKNP |
UniProt ID | P15948 |
MW | 41.8 kDa (predicted) |
Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Expression System | E. coli |
Biological Origin | Mouse |
Biological Activity | Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin. Klk1b22 Protein, Mouse, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 41.8 kDa and the accession number is P15948. |
Expression Region | 25-259 aa |
Storage | -20°C |
Note | For research use only |