You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292327 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant KLK10. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG1 lambda |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | KLK10 (NP_002767, 167 a.a. ~ 276 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | DQCQVAGWGTTAARRVKYNKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIRSN |
Tested applications | ELISA, IF, WB |
Clone Number | 1G8 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_002767 |
Detection limit for recombinant GST tagged KLK10 is approximately 1 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to KLK10 on A-431 cell. [antibody concentration 10 ug/ml]
KLK10 monoclonal antibody (M01), clone 1G8 Western Blot analysis of KLK10 expression in A-431.
Western Blot detection against Immunogen (37.84 KDa).