KLK10 monoclonal antibody (M01), clone 1G8

• Catalog Number: orb2292327
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant KLK10.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1G8
• Tested applications: ELISA, IF, WB
• Reactivity: Human
• Isotype: IgG1 lambda
• Immunogen: KLK10 (NP_002767, 167 a.a. ~ 276 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: DQCQVAGWGTTAARRVKYNKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIRSN
• NCBI: NP_002767
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged KLK10 is approximately 1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to KLK10 on A-431 cell. [antibody concentration 10 ug/ml]

KLK10 monoclonal antibody (M01), clone 1G8 Western Blot analysis of KLK10 expression in A-431.

Western Blot detection against Immunogen (37.84 KDa).