KLHDC8A Rabbit Polyclonal Antibody

• Catalog Number: orb577826
• Category: Antibodies
• Description: Rabbit polyclonal antibody to KLHDC8A
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human KLHDC8A
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 39kDa
• Target: KLHDC8A
• UniProt ID: Q8IYD2
• Protein Sequence: Synthetic peptide located within the following region: PGKNKWEILPAMPTPRCACSSIVVKNCLLAVGGVNQGLSDAVEALCVSDS
• NCBI: NP_060673
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Rabbit Anti-KLHDC8A antibody, Paraffin Embedded Tissue: Human Lung, cell Cellular Data: bronchiole epithelium, Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.

WB Suggested Anti-KLHDC8A Antibody Titration: 1.25 ug/ml, Positive Control: Jurkat cell lysate.