KLF12 Rabbit Polyclonal Antibody

• Catalog Number: orb576890
• Category: Antibodies
• Description: Rabbit polyclonal antibody to KLF12
• Target: KLF12
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Canine, Guinea pig, Rabbit
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KLF12
• Protein Sequence: Synthetic peptide located within the following region: NIHMKRKTIKNINTFENRMLMLDGMPAVRVKTELLESEQGSPNVHNYPDM
• UniProt ID: Q9Y4X4
• MW: 44kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: AP2REP, AP-2rep, HSPC122
• Note: For research use only
• NCBI: NP_009180

WB Suggested Anti-KLF12 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: 721_B cell lysate. KLF12 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.