KIR2DS3 Protein, Human, Recombinant (His)

• Catalog Number: orb1978326
• Category: Proteins
• Description: Receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells.
• Tag: N-6xHis
• Protein Sequence: HEGFRRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGTFNDTLRLIGEHIDGVSKANFSIGRMRQDLAGTYRCYGSVPHSPYQFSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSWSSYDMYHLSTEGEAHERRFSAGPKVNGTFQADFPLGPATQGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLH
• UniProt ID: Q14952
• MW: 26.7 kDa (predicted)
• Application notes: A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
• Expression System: P. pastoris (Yeast)
• Biological Origin: Human
• Expression Region: 22-245 aa
• Storage: -20°C
• Note: For research use only
• Expiration Date: 6 months from date of receipt.