You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1978327 |
---|---|
Category | Proteins |
Description | Receptor on natural killer (NK) cells for some HLA-C alleles such as w6. Does not inhibit the activity of NK cells. |
Tag | N-6xHis |
Protein Sequence | HEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMRQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVIIGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGTKVNGTFQANFPLGPATHGGTYRCFGSFRDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLH |
UniProt ID | Q14954 |
MW | 26.8 kDa (predicted) |
Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Expression System | P. pastoris (Yeast) |
Biological Origin | Human |
Expression Region | 22-245 aa |
Storage | -20°C |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
28.8 kDa (predicted) |