You have no items in your shopping cart.
Cart summary
Item 1 of 1
KIR2DL3 Rabbit Polyclonal Antibody
Catalog Number: orb586384
| Catalog Number | orb586384 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to KIR2DL3 |
| Target | KIR2DL3 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Human |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human KIR2DL3 |
| Protein Sequence | Synthetic peptide located within the following region: GTSVVIILFILLLFFLLHRWCCNKKNAVVMDQEPAGNRTVNREDSDEQDP |
| UniProt ID | P43628 |
| MW | 26kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | p58, NKAT, GL183, NKAT2, CD158b, KIR2DL, NKAT2A, N Read more... |
| Note | For research use only |
Sample Type: Fetal Brain lysates, Antibody dilution: 1.0 ug/ml.
- Item 1 of 3
- Item 1 of 2
Anti-CD158b2 Antibody [orb340772]
IF, WB
Human, Mouse
Rabbit
Polyclonal
Unconjugated
200 μl, 100 μl, 50 μl - Item 1 of 2
- Item 1 of 1
- Item 1 of 1
