KIN Rabbit Polyclonal Antibody

• Catalog Number: orb573897
• Category: Antibodies
• Description: Rabbit polyclonal antibody to KIN
• Target: KIN
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KIN
• Protein Sequence: Synthetic peptide located within the following region: LKTIGSSASVKRKESSQSSTQSKEKKKKKSALDEIMEIEEEKKRTARTDY
• UniProt ID: O60870
• MW: 45kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: BTCD, Rts2, KIN17
• Note: For research use only
• NCBI: NP_036443

Human kidney

Human Spermatophore

WB Suggested Anti-KIN Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:2500, Positive Control: HepG2 cell lysate, KIN is supported by BioGPS gene expression data to be expressed in HepG2.