You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
KIF25 Rabbit Polyclonal Antibody
Catalog Number: orb574883
| Catalog Number | orb574883 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to KIF25 |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | IHC, WB |
| Predicted Reactivity | Canine, Equine, Guinea pig, Rat |
| Reactivity | Human |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human KIF25 |
| Concentration | 1.0 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 41kDa |
| Target | KIF25 |
| UniProt ID | Q9UIL4 |
| Protein Sequence | Synthetic peptide located within the following region: VLGALLEHRGHAPYRNSRLTHLLQDCLGGDAKLLVILCISPSQRHLAQTL |
| NCBI | NP_085118 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | KNSL3 Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Human kidney
WB Suggested Anti-KIF25 Antibody Titration: 2.5 ug/ml, Positive Control: HepG2 cell lysate.
- Item 1 of 1
- Item 1 of 1
