KIF22 Rabbit Polyclonal Antibody

• Catalog Number: orb574882
• Category: Antibodies
• Description: Rabbit polyclonal antibody to KIF22
• Target: KIF22
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rat, Yeast
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human KIF22
• Protein Sequence: Synthetic peptide located within the following region: LASQGSQGAPLLSTPKRERMVLMKTVEEKDLEIERLKTKQKELEAKMLAQ
• UniProt ID: Q14807
• MW: 73kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: KID, OBP, KNSL4, OBP-1, OBP-2, SEMDJL2, A-328A3.2
• Research Area: Cell Biology, Molecular Biology
• Note: For research use only
• NCBI: NP_015556

WB Suggested Anti-KIF22 Antibody Titration: 2.5 ug/ml, Positive Control: Jurkat cell lysate, KIF22 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.