KIF15 Rabbit Polyclonal Antibody

• Catalog Number: orb574886
• Category: Antibodies
• Description: Rabbit polyclonal antibody to KIF15
• Target: KIF15
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat, Yeast
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KIF15
• Protein Sequence: Synthetic peptide located within the following region: SKKHSGLLQSAQEELTKKEALIQELQHKLNQKKEEVEQKKNEYNFKMRQL
• UniProt ID: Q9NS87
• MW: 160kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: KLP2, HKLP2, KNSL7, NY-BR-62
• Note: For research use only
• NCBI: NP_064627

Positive control (+): MCF7 Cell Lysate (N10), Negative control (-): Human Liver Tumor (T-LI), Antibody concentration: 3 ug/ml.

WB Suggested Anti-KIF15 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: COLO205 cell lysate.